Protein Info for PFR28_04764 in Pseudomonas sp. RS175

Annotation: Sulfate transport system permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 205 to 230 (26 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 20 to 277 (258 residues), 317.1 bits, see alignment E=9.9e-99 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 22 to 279 (258 residues), 395.7 bits, see alignment E=9.9e-123 PF00528: BPD_transp_1" amino acids 84 to 280 (197 residues), 54 bits, see alignment E=9.3e-19

Best Hits

Swiss-Prot: 52% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 96% identity to pba:PSEBR_a184)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>PFR28_04764 Sulfate transport system permease protein CysW (Pseudomonas sp. RS175)
MSQSSIAAASTNAARRGSAVSRRILIGLGWLIFALFLLLPLFIVVSQGLKSGLGTFFAAI
LEPDALSALKLTVIAVLISVPLNLVFGVSAAWCVSKYSFRGKSMLVTLIDLPFSVSPVIA
GLVYVLMFGAQGLFGPWLSDRDIQIVFALPGIVLATIFVTVPFVARELIPLMQEQGTQEE
EAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEFGAVSVVSGHIRGVTNTLPL
HVEILYNEYNHVAAFAVASLLLILALLILLLKQWSENRINRLRASAAEE