Protein Info for PFR28_04747 in Pseudomonas sp. RS175

Annotation: Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 92 to 113 (22 residues), see Phobius details PF08240: ADH_N" amino acids 30 to 90 (61 residues), 43.9 bits, see alignment E=2.8e-15 PF00107: ADH_zinc_N" amino acids 159 to 259 (101 residues), 61.7 bits, see alignment E=1.1e-20 PF13602: ADH_zinc_N_2" amino acids 191 to 328 (138 residues), 72.1 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a169)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>PFR28_04747 Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 (Pseudomonas sp. RS175)
MNDTMLAAIAETAQAPLVIRPVARPVPGKGQVLIKVHAAGINPLDTKIATGGGAHARQPL
PAVLGIDLAGTVVELGDGVTDFTRGDEVFGMAAGIGGIQGALAQYVAVDALLIAPKPRSM
SMREAAALPLVFITAWEGLVDRANVRAGQQVLIHGGAGGVGQMAVQIAKARGARVYATGS
AGSLDFIRELGATAIDYRIQDTDSYVRLHTDDEGFDIVYDTVGGSTLDASFSAVKAYTGH
VLSCLGWGQHSLAPLSFRGASYSGVFTLMPLLTGKGREHHGQILRQAAALVEAGQLRIKV
DVHRFGLDDVNDAFKQVAQGLGAGKTVVDM