Protein Info for PFR28_04739 in Pseudomonas sp. RS175

Annotation: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03938: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB" amino acids 48 to 662 (615 residues), 896.5 bits, see alignment E=3.8e-274 PF01522: Polysacc_deac_1" amino acids 101 to 267 (167 residues), 77.2 bits, see alignment E=1.1e-25 PF14883: GHL13" amino acids 315 to 641 (327 residues), 481.3 bits, see alignment E=1.4e-148

Best Hits

KEGG orthology group: K11931, biofilm PGA synthesis lipoprotein PgaB [EC: 3.-.-.-] (inferred from 92% identity to pba:PSEBR_a161)

Predicted SEED Role

"Biofilm PGA synthesis deacetylase PgaB (EC 3.-)"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (665 amino acids)

>PFR28_04739 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase (Pseudomonas sp. RS175)
MPVISRFILLLGVLLVSACAQQAPAFTPPSQRPLAANEAPWPKNHVLGIAYHDVNDRDPD
QALVAVRTERLIEQLAWLRENNYQPVTVDQIITARNGGPQLPPRAVLLSFDDGYSSFYTR
VMPILRAYNWPAILAPVGSWIDTPSNQTVDFAGVPRKRSEFLTWEQIREVSKSGLVEIAA
HTDANHKGVLANPQGNQQPAATTRRYDPATGRYETEADFQARLRQDVAAISEKIRKVAGY
NPRVWVWPYGEADGTALQVIGDHGYQMALTLEDGLDSLSNLMSGPRFLVASDPDGAHFAE
SMVSVQTMDPMRVVHVDLDYVYDPDPVQQEANVGKLIQRIYDLGANTVFLQAFADPKGDG
LVHSLYFPNRHLPVRADLFDRVAWQLKTRANAKVFAWMPVLGFALDSKLPRVQRWDPETG
RTGIAKDQYVRLSPFDPKVRHVIGEIYEDMARMSSVDGVLYHDDAVFSDFEDAGPAALKV
YAANGLSTSIAALRDDPAAMQRWTRFKSRYLIDFTQELTAKVRAIRGPQVQTARNLFAEP
MLNPESEAWFAQNLDDFLGAYDWTAPMAMPLMEKQTRRQSGPWLERLVNTVKARPGALQR
TVFELQARDWHSQPAKDIDGEQLAEWMGVLKRQGVTSFGYYPDNFIEDQPAVKTVRPALS
NKWNP