Protein Info for PFR28_04694 in Pseudomonas sp. RS175

Annotation: Carbonic anhydrase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 59 to 214 (156 residues), 173.1 bits, E=2.6e-55

Best Hits

Swiss-Prot: 49% identical to CYNT_ECO57: Carbonic anhydrase 1 (cynT) from Escherichia coli O157:H7

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 98% identity to pba:PSEBR_a98)

MetaCyc: 49% identical to carbonic anhydrase 1 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• 3-hydroxypropanoate cycle (5/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (5/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (243 amino acids)

>PFR28_04694 Carbonic anhydrase 1 (Pseudomonas sp. RS175)
MSDKDKQPLAASASAQPEAETADAALQHIVDGFLHFHHEIFPQQEELFKKLATAQKPRAM
FITCADSRIVPELITHSSPGDLFVTRNVGNVVPPYGQMNGGVSTAIEYAVLALGVQHIIV
CGHSDCGAMRAVLNPDTLEKMPTVKAWLRHAEVAKTMVHDNCPCGDEKQTMPVLTEENVI
AQLQHLRTHPSVASRMASGQLFIHGWVYNIETSEIKAFDADKGCFLPLDGSHPIPVATPK
ARF