Protein Info for PFR28_04678 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 36 to 53 (18 residues), see Phobius details PF01638: HxlR" amino acids 35 to 121 (87 residues), 101.5 bits, see alignment E=9.4e-34

Best Hits

Swiss-Prot: 59% identical to YTFH_SHIFL: Uncharacterized HTH-type transcriptional regulator YtfH (ytfH) from Shigella flexneri

KEGG orthology group: None (inferred from 68% identity to psp:PSPPH_2859)

Predicted SEED Role

"Redox-sensing transcriptional regulator QorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>PFR28_04678 hypothetical protein (Pseudomonas sp. RS175)
MDTATENSESFSAAVRRGDVLSADCPSREVLKHMTSRWGVLVLVILLGGMHRFSELRRKI
GGVSEKMLSQTLQELEADGLVDRKSLPVVPPHVEYRLTPLGREAAEHLEVMVNWIEEKIP
QIMAVRRGRLEGGAQE