Protein Info for PFR28_04643 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 137 to 155 (19 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 263 to 308 (46 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 129 to 377 (249 residues), 231.7 bits, see alignment E=5.9e-73 PF02405: MlaE" amino acids 166 to 375 (210 residues), 237.7 bits, see alignment E=5.5e-75

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 93% identity to pba:PSEBR_a57)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>PFR28_04643 hypothetical protein (Pseudomonas sp. RS175)
MTPSPSMGSARLDTSGSPAQLWISGDWTLAHYAQLKRLSESLRGQYDENARIDLNGLGAL
DTAGASLLVELLGSERLGKTAEHPDCSLPAAERALLQTVYCSLTDFCVPDKEPKVSVVTQ
LLTRIGRAVEKVWQDTLQLLGFVGLILETLARGLFHPRRWRITPMVVHIEQTGLDAAPIV
ALLTFLVGAVVAFLGATVLADFGASIFTVDLVAFSFLREFGVLLTAILMAGRTASAFTAQ
IGSMKANEEIDAIRTLGLDPVELLVLPRVLALLVALPMLTFVAMLAGIIGGGVVCALSLG
ISPAMFLSLLQSDIGVQHFVVGMVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVV
QSIFVVIVLDAVAALFFMEMSW