Protein Info for PFR28_04597 in Pseudomonas sp. RS175

Annotation: Sensor histidine kinase WalK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details PF02518: HATPase_c" amino acids 394 to 499 (106 residues), 85.6 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: None (inferred from 83% identity to pba:PSEBR_a8)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>PFR28_04597 Sensor histidine kinase WalK (Pseudomonas sp. RS175)
MSHQRRRESREPTQAQRLFRQLVREWLWISLLLLPLTALLSFSAQPTRNGPAALLSVCLV
ACVLGLLLLRPRLALWTTVGGMGLALTLSAVLGAQGWWWSPLASVLGMLFGYLIWNWRRL
SVVLAYFGWELARLDAEPKVFPERRRAPYTGSDRLQGQVMALEQAMSRTRDTRRFIADGL
EYLPVATMISDPHGKVLLGNRKARELFGRGLAGEDVVEHLAQLGYPGLVPGCPHRLSTLP
LLEFRDVQDRSLRLERASLLPADGDVPVGWLLSLTDLSAEREAEEQRNIMLRFLSHDLRA
PHSAILALLDVQRNQAGTTDPVFDQIERQVRRALALTDGFVQLARAESEVYQFRPTLFAM
LVLDVLDQALPLAQAKHIQIAHDIDDEEAMVSADQALLTRALFNLLENAIKYSPPATRIV
VRVRCAEGRLTCDLVDQGKGIEAGELPDLFSQYRRFSSAHGVDGVGLGLSMVKAVVDRHG
GQIECRSVVGEGTTFSFGLALLDTEKAQPSVVL