Protein Info for PFR28_04586 in Pseudomonas sp. RS175

Annotation: Ribosomal RNA small subunit methyltransferase G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02527: GidB
  • amino acids 28 to 207 (180 residues), 216.9 bits, E=1.5e-68
• TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
  • amino acids 33 to 211 (179 residues), 186.5 bits, E=1.8e-59
• PF05175: MTS
  • amino acids 59 to 146 (88 residues), 23.5 bits, E=3.9e-09

Best Hits

Swiss-Prot: 92% identical to RSMG_PSEPF: Ribosomal RNA small subunit methyltransferase G (rsmG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 93% identity to pba:PSEBR_a5660)

MetaCyc: 48% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Protein Sequence (214 amino acids)

>PFR28_04586 Ribosomal RNA small subunit methyltransferase G (Pseudomonas sp. RS175)
MSSLVTSQHAEELSTGARQLGVCLSETQHAQLLDYLALLIKWNKAYNLTAVRDPDEMVSR
HLLDSLSVMSFIENGRWLDVGSGGGMPGIPLAILFPEAQVTCLDSNGKKTRFLTQVKLEL
KLDNLQVIHSRVEAFQPALPFDGIISRAFSSMENFTNWTRHLGGGNTRWLAMKGVHPADE
LVALPADFHLDSEHALAVPGCQGQRHLLILRRTA