Protein Info for PFR28_04568 in Pseudomonas sp. RS175

Annotation: Na(+)/H(+)-K(+) antiporter GerN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 47 (15 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 7 to 391 (385 residues), 153.4 bits, see alignment E=4.1e-49

Best Hits

KEGG orthology group: None (inferred from 48% identity to vpe:Varpa_4084)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>PFR28_04568 Na(+)/H(+)-K(+) antiporter GerN (Pseudomonas sp. RS175)
MLLIQILFVMLSAKLLGAVFNRLGQPQVVGEMIAGFVLGPVVLGQLFPVFHQQLFDSQAI
TQLKVLSELGILLFMFVIGAEFRFPLTQSRTGLKAIIIGCFSIVIPFSLGAAIAPWLFEH
FATPQVSRLSFVLFIGTVFSVTAFPVLARILKERGMLGTQTGAIALLAAAMSDVVAWMLI
AAVAMVNGQDSNWMALAARGACLLLLVAFSFLVLKPLLARWLAAEGRLAQPMVLVALLAG
VLIYGSLTHALQVHAVFGAFLFGLCLPREQRLLDMIIERLEHVSLIILMPCFFTLAGLST
TASAFSGLGLLGLLVILLVAVVGKVAGSGLGARLVGCSWSTSLTVGALMNTRGLMELVVL
KIGLDMGIIGNGLFTALVIMTIITTLMTGPLMSLQNRKVFSSWALSKP