Protein Info for PFR28_04566 in Pseudomonas sp. RS175

Annotation: 4-chloro-allylglycine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF14518: Haem_oxygenas_2" amino acids 77 to 230 (154 residues), 66.1 bits, see alignment E=1.9e-22

Best Hits

Swiss-Prot: 47% identical to BESC_STREN: 4-chloro-allylglycine synthase (besC) from Streptomyces cattleya (strain ATCC 35852 / DSM 46488 / JCM 4925 / NBRC 14057 / NRRL 8057)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>PFR28_04566 4-chloro-allylglycine synthase (Pseudomonas sp. RS175)
MSITQETFQSETAYVVRNEGVDLELKLFMDEQIDYILKHRATEHPFLNTYAQHGLPPEQS
KVLYLETLHYFKYLPFYVCGISTITRDEAVLRTIAFNARDELGETQSHSDLYRKFLLDKG
ISEEQIDSYKCLPSTQALNDGICALYSKPPLQKALGGLFADEAMSASMVSKYNDGLIKEG
VSERGRFFWTLHMEVEVGHSNAVFNVMEKHLQTPEERRLFAEGIEQYLHLMEVYWDGIER
KLNSEVRQ