Protein Info for PFR28_04565 in Pseudomonas sp. RS175

Annotation: Protein RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details PF00892: EamA" amino acids 10 to 144 (135 residues), 44.4 bits, see alignment E=9.4e-16 TIGR00688: protein RarD" amino acids 10 to 264 (255 residues), 145.4 bits, see alignment E=1.1e-46

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 36% identity to smk:Sinme_0913)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>PFR28_04565 Protein RarD (Pseudomonas sp. RS175)
MTVKNESGQGVAFGLGATLLWGSYPLWYKPLAGLDAYHLLSWRVVFAELFLVALVLVTAR
VATLRSTLKTVRPTNVLTVSAVLGLWWLMYIYGIMTGRVLEVAFGYFLSPIMSMVVSRLI
FKERLTTLQTWAIFLAVTGVTLMAFELLNLHSFPWIALVIGFCYSFYGIFKKKVPGDPVV
IQTLEIAVLLPFAAVFLLWAQAQGMGHQFLQSGTRDLLLVATGLITVLPLWWYSLAAKQL
SMITLGFLQFVPPICNFLLAAFVYGEPVSSLKLAAFSFIWLALALFTWNSIRVQRAAAAA
RLSVQMRTA