Protein Info for PFR28_04537 in Pseudomonas sp. RS175

Annotation: Manganese-binding lipoprotein MntA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01297: ZnuA" amino acids 24 to 287 (264 residues), 272 bits, see alignment E=2.7e-85

Best Hits

Swiss-Prot: 32% identical to MNTA_LISIN: Manganese-binding lipoprotein MntA (mntA) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K02077, zinc/manganese transport system substrate-binding protein (inferred from 91% identity to pba:PSEBR_a5611)

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>PFR28_04537 Manganese-binding lipoprotein MntA (Pseudomonas sp. RS175)
MRALLVLFSLLLSTSLSAAERLQVVTSFSILADMTRQVGGEHVQITNMVGPDADAHTYEP
TPDDAKALLSAKLIIKNGLGFEPWLDRLVASTETAAPVISASRGVIPRSLDEDGETVPDP
HAWHNLANALLYVRNISKALEAADPANKADYVRNSEAYLNKIYALLAEARTRFGSLPPGN
RKIVTSHDAFGYLGQAYGIEFMAPQGLSTEREPSAAEVAALITQIRQAKVKAVFMENIKD
ARLLKQIADESGAHIGGTLYSDALAASGSASTFIGLFEYNLNTLYDALSRP