Protein Info for PFR28_04500 in Pseudomonas sp. RS175

Annotation: Amino-acid carrier protein AlsT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 230 to 255 (26 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 377 to 393 (17 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 432 (420 residues), 472.3 bits, see alignment E=7.1e-146 PF01235: Na_Ala_symp" amino acids 48 to 445 (398 residues), 511.5 bits, see alignment E=1e-157

Best Hits

Swiss-Prot: 47% identical to GLNT_BACSU: Probable sodium/glutamine symporter GlnT (glnT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 94% identity to pba:PSEBR_a108)

Predicted SEED Role

"sodium/alanine transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>PFR28_04500 Amino-acid carrier protein AlsT (Pseudomonas sp. RS175)
MLEVINDFLSGKVLIVLIVGLGGYFTIRSRFVQFRHFFHMFSVFRDSLKSSTDQLSSFQA
LMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMSSSFFECSLGQLYKRCDSEG
QYRGGPSYYIQHGLQKRWLGMIMAFLLLVTFGFAFNGLQAHAVTHSLNNAFGLDTTYTGL
GLAVLLGLVFIGGIKRIAKVADLLVPVKTLAYIAVTIYVIVLQFDHVPAMLVTIVKSAFG
LDQAFGGLIGSAIVMGVKRGVFANEAGLGSAPNVAAVASVEHPVAQGVVQAFSVFLDTFV
ICTCTALLILLSGFYTPGFEGDGIALTQNSLAAVVGDWGRMFISVALALFVFTSILYNYY
LGENNLRFMVGENRKALIGYRALVLVLIFWGAIENLSTVFAFADITMTLLAFVNLIALFL
LFKVGMRILRDYDDQRSCGIKVPVFDSARFPDLDLDRKAWPANPSSAPQPEAVTGATAAQ
R