Protein Info for PFR28_04487 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 305 to 333 (29 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details amino acids 451 to 474 (24 residues), see Phobius details amino acids 521 to 543 (23 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 288 to 548 (261 residues), 247.1 bits, see alignment E=9.2e-78 PF00528: BPD_transp_1" amino acids 324 to 548 (225 residues), 60.3 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 97% identity to pba:PSEBR_a120)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>PFR28_04487 hypothetical protein (Pseudomonas sp. RS175)
MKQHSLKGWFKSGAPGVWISGGAVSIAVIMTIGLLAVIAVRGLGHFWPADLIHASYNVPG
MPSHLVVGEVVQKEEVPRERLKSAGLPVPDEGPEFMTRELVKVGNRDLNGTDFTWIVGDW
LTNQTTPPELMAIERREWGNFYGYLVNVKEEGKVVAEGEAAWPQLQARVERVNQLAAELK
TLEKVEIGAINAGLERIRLHGRKLELDGKLDAAAQADLDSERAELNARYKDIEARLTDLH
AQFNRDSLTARDANGKEVEISIGKVVHAYQPNGMGTFTKLGFYFSKVWEFLSDDPREANT
EGGIFPAIFGTVMMTLIMAMIVTPFGVLAAVYLREYARQGTMTRLIRIAVNNLAGVPAIV
YGVFGLGFFVYVLGGSVDRLFFPEALPAPTFGTPGLLWASLTLALLAVPVVIVATEEGLA
RIPRTVREGSLALGATKAETLWKIVLPMASPAMMTGMILAVARAAGEVAPLMLVGVVKLA
PSLPLDGNYPYLHLDQKIMHLGFHIYDVGFQSPNVEAARPLVYATALLLVLVIAILNLSA
VWIRNHLREKYKALDS