Protein Info for PFR28_04476 in Pseudomonas sp. RS175

Annotation: Chorismate pyruvate-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04345: Chor_lyase
  • amino acids 2 to 154 (153 residues), 175.3 bits, E=8.6e-56
• PF01947: Rv2949c-like
  • amino acids 7 to 150 (144 residues), 22.6 bits, E=9.1e-09

Best Hits

Swiss-Prot: 82% identical to UBIC2_PSEPF: Probable chorismate pyruvate-lyase 2 (ubiC2) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 88% identity to pba:PSEBR_a131)

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (5/9 steps found)
• polybrominated phenols biosynthesis (1/4 steps found)
• spongiadioxin C biosynthesis (2/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (2/8 steps found)
• p-HBAD biosynthesis (1/9 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)
• superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
• phenolphthiocerol biosynthesis (1/23 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Protein Sequence (161 amino acids)

>PFR28_04476 Chorismate pyruvate-lyase (Pseudomonas sp. RS175)
MLDWLYDEGSLTRRLTRLSDDHFSVMPLLEGWQPLRADECAALDLAEGSEGWVREVYLLG
HGEPWVFARSVAARSALEGDGLQMDALGSRSLGELLFCDQAFQRRAIEVCHYPEPWLPAQ
VRAPQLWGRRSRFDRGALSVLVAEIFLPRLWSVARAYSETC