Protein Info for PFR28_04473 in Pseudomonas sp. RS175

Annotation: DNA-binding protein HU-beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 115.6 bits, see alignment E=4.9e-38

Best Hits

Swiss-Prot: 92% identical to DBHA_PSEAE: DNA-binding protein HU-alpha (hupA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05787, DNA-binding protein HU-alpha (inferred from 91% identity to pap:PSPA7_6125)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (91 amino acids)

>PFR28_04473 DNA-binding protein HU-beta (Pseudomonas sp. RS175)
MRKPELAAAIAEKADLTKEQANRVLNAVLEEITGALHRKDSVTLVGFGTFLQRHRGARTG
KNPQTGEPVKIKASNTVAFKPGKSLKDIVNP