Protein Info for PFR28_04400 in Pseudomonas sp. RS175
Annotation: Leucine-responsive regulatory protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to LRP_SHIFL: Leucine-responsive regulatory protein (lrp) from Shigella flexneri
KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 99% identity to pfo:Pfl01_5527)Predicted SEED Role
"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (162 amino acids)
>PFR28_04400 Leucine-responsive regulatory protein (Pseudomonas sp. RS175) MRTNTQTKRELDKIDRNILRILQADGRISFTELGEKVGLSTTPCTERVRRLEREGIIMGY NARLNPQHLKGSLLVFVEISLDYKSGDTFEEFRRAVLKLPHVLECHLVSGDFDYLVKARI SEMASYRKLLGDILLKLPHVRESKSYIVMEEVKESLNLPIPD