Protein Info for PFR28_04355 in Pseudomonas sp. RS175

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details amino acids 27 to 27 (1 residues), see Phobius details transmembrane" amino acids 26 to 26 (1 residues), see Phobius details amino acids 47 to 75 (29 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 204 (189 residues), 118 bits, see alignment E=1.9e-38

Best Hits

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 92% identity to pba:PSEBR_a5467)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>PFR28_04355 Homoserine/homoserine lactone efflux protein (Pseudomonas sp. RS175)
MLLETWLAFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNALGLQLGLALQIVIVAAG
VGAILTASATAFYAIKWFGVAYLVYLGVKQWRAIPGDISDDAAVRPIGKPMALVFRGLLV
NISNPKALVFMLAVLPQFIDPHAPLVKQYLILGVTMICVDLVVMAGYTGLASKVLRLLRT
PKQQRRMNRTFAGLFIGAAGLLATIRKAAV