Protein Info for PFR28_04333 in Pseudomonas sp. RS175

Annotation: Glycerol-3-phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details TIGR00712: glycerol-3-phosphate transporter" amino acids 1 to 433 (433 residues), 777.1 bits, see alignment E=5.8e-238 PF07690: MFS_1" amino acids 34 to 399 (366 residues), 175.9 bits, see alignment E=5.9e-56 TIGR00881: phosphoglycerate transporter family protein" amino acids 35 to 417 (383 residues), 515.2 bits, see alignment E=1e-158

Best Hits

Swiss-Prot: 73% identical to GLPT_ECOLI: Glycerol-3-phosphate transporter (glpT) from Escherichia coli (strain K12)

KEGG orthology group: K02445, MFS transporter, OPA family, glycerol-3-phosphate transporter (inferred from 95% identity to pfo:Pfl01_5451)

MetaCyc: 73% identical to sn-glycerol 3-phosphate:phosphate antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-22

Predicted SEED Role

"Glycerol-3-phosphate transporter" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>PFR28_04333 Glycerol-3-phosphate transporter (Pseudomonas sp. RS175)
MFAFFRPATHQAPLPEEKIDSTYRRLRWQIFAGIFIGYAGYYLLRKNFSLAMPYLIDEGY
TRGQLGVAMSAIAIAYGLSKFLMGLVSDRSNPRYFLPFGLLVSAGVMFIFGFAPWATSSV
TMMFILLFINGWAQGMGWPPSGRTMVHWWSQKERGGVVSVWNVAHNVGGGLIGPLFLLGM
GWFNDWHAAFYVPAAVALMVALFAFATMRDTPQSVGLPPIEKYKDDYPEGYDASHENEFS
TKEIFVKYVLRNKMLWYIALANVFVYLLRYGVLDWAPTYLKEAKGFTVDKSSWAYFFYEW
AGIPGTLLCGWMSDKIFRGNRGLTGMVFMALVTVATLVYWLNPAGNPTVDMIALVSIGFL
IYGPVMLIGLQALELAPKKAAGTAAGFTGLFGYLGGSVAASAAMGYTVDHFGWNGGFVLL
VGACLLAMAFLAPTLGHKQVASQSREVTA