Protein Info for PFR28_04308 in Pseudomonas sp. RS175

Annotation: Amino-acid acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 TIGR01890: amino-acid N-acetyltransferase" amino acids 4 to 432 (429 residues), 731.5 bits, see alignment E=1.6e-224 PF00696: AA_kinase" amino acids 37 to 259 (223 residues), 75.4 bits, see alignment E=8.9e-25 PF00583: Acetyltransf_1" amino acids 320 to 403 (84 residues), 43.7 bits, see alignment E=4.7e-15 PF13508: Acetyltransf_7" amino acids 325 to 405 (81 residues), 44.9 bits, see alignment E=1.9e-15

Best Hits

Swiss-Prot: 96% identical to ARGA_PSEPF: Amino-acid acetyltransferase (argA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 98% identity to pba:PSEBR_a5417)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>PFR28_04308 Amino-acid acetyltransferase (Pseudomonas sp. RS175)
MPEYVNWLRHASPYINAHRDCTFIVMLPGDGVEHPNFGNIVHDLVLLHSLGVRLVLVHGS
RPQIETRLAARGLTPHYHRGMRITDAATLECVIDAVGQLRIAIEARLSMDMASSPMQGSR
LRVASGNLVTARPIGVLEGVDYHHTGEVRRVDRKGINRLLDERSIVLLSPLGYSPTGEIF
NLACEDVATRAAIDLAADKLLLFGSEQGLIGEDGKLVRELRPQQVPAHMQRLGSDYQAEL
LDAAAQACRGGVARSHIVSYAEDGALLAELFTRDGSGTLVAQEQFEVVREAAIEDVGGLL
ELISPLEEQGILVRRSREVLEREIEQFSVVEREGMIIACAALYQIADSDAGELACLAVNP
EYRHGGRGDELLERIEARARAQGLKTLFVLTTRTAHWFRERGFEPSSVERLPAARASLYN
YQRNSKIFEKAL