Protein Info for PFR28_04291 in Pseudomonas sp. RS175

Annotation: Inner membrane ABC transporter permease protein YdcV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 97 to 124 (28 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 254 (180 residues), 49.7 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 64% identical to POTI_ECOLI: Putrescine transport system permease protein PotI (potI) from Escherichia coli (strain K12)

KEGG orthology group: K11074, putrescine transport system permease protein (inferred from 96% identity to pba:PSEBR_a5399)

MetaCyc: 64% identical to putrescine ABC transporter membrane subunit PotI (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotI (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>PFR28_04291 Inner membrane ABC transporter permease protein YdcV (Pseudomonas sp. RS175)
MKRFRFSSLMLVLGLLFIYAPMVILVIFSFNASKLVTVWGGWSIKWYVGLLDNTQLMGSV
LRSLEIACYTAVAAVALGTLAAFVLTRITRFKGRTLFGGLVTAPLVMPEVITGLSLLLLF
VAMAQMIGWPQERGIVTIWIAHTTFCAAYVAVVVSSRLRELDLSIEEAAMDLGARPWKVF
ILITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLPMEVFSAVRLGVKPEINAV
ASLILLAVSLVTFLVWYFSRRAEENRRRAIQQAIEESAADSWKQPQVRRPEAAPV