Protein Info for PFR28_04282 in Pseudomonas sp. RS175

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 72 to 94 (23 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 171 to 197 (27 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details PF11067: DUF2868" amino acids 146 to 442 (297 residues), 339.1 bits, see alignment E=1.6e-105

Best Hits

KEGG orthology group: None (inferred from 87% identity to pba:PSEBR_a5359)

Predicted SEED Role

"probable integral membrane protein NMA1899"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>PFR28_04282 putative membrane protein (Pseudomonas sp. RS175)
MSEPLTELQKIWLTETVRLREEHTGPLEDQEANRLARAAGGDLSTRIHHRAHRLAARDGL
TEALRHWLQGARLALIVLATVAVISGAGLGFAALGDGRMPVNVFWALGSLLGLNLILLVG
WALGLLFAGEQGAALGRLWLWLSEKLARDAKAAQLAPALLLLLQRQRLNRWALGVLVNGL
WLLAMVSALVVVLMLMATRRYGFVWETTLLGAETFVVLTQALGALPAMVGFDVPAEAMIR
ASGDGALNLESARQAWAAWLVGVTLVYGVMPRLCLALLCLWRWRRGRSTLRLDLNLPGYA
QLRERLMPSSERLGVNDAAPAQLHRIEGTSGAPESDGALLVAIELDDRPWPPKLPDTVKN
AGILDSRESRHKLLEQLSRFPPARLAIACDPRRSPDRGSLALIAELARSASATRVWLMQA
PPGEALDAQRLGDWHDALRQLQLPFADCIPLNWLETGHD