Protein Info for PFR28_04246 in Pseudomonas sp. RS175

Annotation: Bifunctional methionine biosynthesis protein MetXA/MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02081: methionine biosynthesis protein MetW
  • amino acids 2 to 195 (194 residues), 301.2 bits, E=1.4e-94
• PF07021: MetW
  • amino acids 2 to 194 (193 residues), 325.8 bits, E=2.6e-101
• PF13489: Methyltransf_23
  • amino acids 10 to 101 (92 residues), 43.9 bits, E=6.3e-15
• PF13847: Methyltransf_31
  • amino acids 15 to 104 (90 residues), 42.1 bits, E=2.3e-14
• PF13649: Methyltransf_25
  • amino acids 18 to 102 (85 residues), 42.2 bits, E=3.3e-14
• PF08241: Methyltransf_11
  • amino acids 19 to 104 (86 residues), 48.5 bits, E=3.4e-16
• PF08242: Methyltransf_12
  • amino acids 19 to 101 (83 residues), 31 bits, E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a5326)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Protein Sequence (206 amino acids)

>PFR28_04246 Bifunctional methionine biosynthesis protein MetXA/MetW (Pseudomonas sp. RS175)
MRADLEIIQEWIPAGSRVLDLGCGNGELLTWLRDNKQVTGYGLENDPDNIAECVAKGINV
IEQDLDKGLGNFASNSFDIVVMTQALQAVHYPDRILDEMLRVGRQCIITFPNFGHWRCRW
YLASKGRMPVSEFLPYTWYNTPNIHFCTFEDFEELCRERQAKVIDRLAVDQQHRHGWASK
LWPNLLGEIGIYRVSSPGLADHQIAV