Protein Info for PFR28_04234 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF02622: DUF179" amino acids 18 to 176 (159 residues), 161.3 bits, see alignment E=9.8e-52

Best Hits

Swiss-Prot: 89% identical to Y5830_PSEF5: UPF0301 protein PFL_5830 (PFL_5830) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 97% identity to pba:PSEBR_a5313)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>PFR28_04234 hypothetical protein (Pseudomonas sp. RS175)
MKNVSPTYLKHHFLIAMPHMADPNFAHTLTYIVEHTANGAMGLVINRPQELNLADILEQL
RPEVEPPLLCQHVPIFIGGPVQTDRGFVLHPSGPSYQATVDLNGVSLSTSQDILFAIADG
VGPEKSLIALGYAGWEAGQLEAELADNAWLTCPFDADILFNTSSELRLEAAASRLGINLS
LLTSQAGHA