Protein Info for PFR28_04100 in Pseudomonas sp. RS175

Annotation: Malonyl-[acyl-carrier protein] O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 22 to 267 (246 residues), 246 bits, see alignment E=2.5e-77 PF13489: Methyltransf_23" amino acids 36 to 197 (162 residues), 42.9 bits, see alignment E=1.6e-14 PF01209: Ubie_methyltran" amino acids 52 to 151 (100 residues), 37.9 bits, see alignment E=4.7e-13 PF01728: FtsJ" amino acids 55 to 148 (94 residues), 22.7 bits, see alignment E=3e-08 PF13847: Methyltransf_31" amino acids 56 to 167 (112 residues), 50.7 bits, see alignment E=6e-17 PF08242: Methyltransf_12" amino acids 57 to 148 (92 residues), 47.9 bits, see alignment E=6.7e-16 PF13649: Methyltransf_25" amino acids 57 to 146 (90 residues), 70.8 bits, see alignment E=4.6e-23 PF08241: Methyltransf_11" amino acids 58 to 150 (93 residues), 80.8 bits, see alignment E=3.2e-26

Best Hits

Swiss-Prot: 70% identical to BIOC_PSEA7: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 88% identity to pba:PSEBR_a5178)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>PFR28_04100 Malonyl-[acyl-carrier protein] O-methyltransferase (Pseudomonas sp. RS175)
MTDLSLPKLPPALPDKRQVAASFSRAAASYDSVAELQRDVGQLLLERLPPMVPGRWMDLG
CGTGYFTRALGARFGEANGLALDIAEGMLRHARPQGGAAYFVAGDAERLPLEAASCDLMF
SSLAVQWCEAFDSVLSEAYRVLKPGGVFAFTSLCVGTLHELRDSWRQVDGLVHVNRFREF
ETYRKLCAASGLSVVSLEKHPHVLHYPDVRSLTHELKALGAHNLNPGRPGGLTGRARILA
LVEAYERFRQTQGLPATYQVVYAILEKPL