Protein Info for PFR28_04099 in Pseudomonas sp. RS175

Annotation: ATP-dependent dethiobiotin synthetase BioD 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 4 to 214 (211 residues), 130.1 bits, E=9.9e-42
• PF01656: CbiA
  • amino acids 6 to 212 (207 residues), 53.3 bits, E=2.7e-18
• TIGR00347: dethiobiotin synthase
  • amino acids 6 to 177 (172 residues), 145 bits, E=1.2e-46

Best Hits

Swiss-Prot: 76% identical to BIOD_PSEA7: ATP-dependent dethiobiotin synthetase BioD (bioD) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 95% identity to pba:PSEBR_a5177)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Protein Sequence (226 amino acids)

>PFR28_04099 ATP-dependent dethiobiotin synthetase BioD 1 (Pseudomonas sp. RS175)
MSQAYFITGTDTDVGKTTVAAGLLHAARQAGMSTAAGKPVASGCEITPKGLRNADALALL
AECSMPLGYAQVNPVAFEPAIAPHLAAREAGVALTVQSLLGPMREVLALNADFTLIEGAG
GWRVPLADQDNLSDLAMALGLPVILVVGVRLGCISHALLTAEAIARDGLQLAGWVANIID
PKTSRLEENLATLAERLPAPCLGRVPRIKGVTAEIVAGHLHLDLLE