Protein Info for PFR28_04087 in Pseudomonas sp. RS175

Annotation: Coenzyme PQQ synthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02108: coenzyme PQQ biosynthesis protein B
  • amino acids 3 to 303 (301 residues), 448.6 bits, E=4.9e-139
• PF12706: Lactamase_B_2
  • amino acids 50 to 270 (221 residues), 169.3 bits, E=4.2e-54

Best Hits

Swiss-Prot: 96% identical to PQQB_PSEFS: Coenzyme PQQ synthesis protein B (pqqB) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K06136, pyrroloquinoline quinone biosynthesis protein B (inferred from 96% identity to pfs:PFLU5599)

Predicted SEED Role

"Coenzyme PQQ synthesis protein B" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Protein Sequence (303 amino acids)

>PFR28_04087 Coenzyme PQQ synthesis protein B (Pseudomonas sp. RS175)
MFVQILGSAAGGGFPQWNCNCVNCAGFRNGTLRAQARTQSSIAISDDGVNWVLCNASPDI
RAQLQSFAPMQPGRALRDTGIGAIILMDSQIDHTTGLLSLREGCPHQVWCTDMVHEDLST
GFPLFNMLTHWNGGLNWNRIELDQGFTVPACPNLRFTPLPLRSAAPPYSPHRFDPHPGDN
IGLIVEDLRTGGKLFYAPGLGKVDAPLLEIMAGSDCLLVDGTMWDDDEMQRRGVGTRTGR
EMGHLAQNGPGGMLEVLEQLPEQRKVLIHINNTNPILDEDSPERAELVRRRIEVAYDGMS
IEL