Protein Info for PFR28_04062 in Pseudomonas sp. RS175

Annotation: Chaperone SurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13624: SurA_N_3" amino acids 24 to 148 (125 residues), 51 bits, see alignment E=4.7e-17 PF13623: SurA_N_2" amino acids 29 to 112 (84 residues), 32.4 bits, see alignment E=2.5e-11 PF09312: SurA_N" amino acids 32 to 149 (118 residues), 148.1 bits, see alignment E=4e-47 PF13145: Rotamase_2" amino acids 159 to 291 (133 residues), 33.8 bits, see alignment E=1.5e-11 amino acids 293 to 390 (98 residues), 36.6 bits, see alignment E=2.2e-12 PF13616: Rotamase_3" amino acids 174 to 281 (108 residues), 49.8 bits, see alignment E=1.4e-16 amino acids 284 to 388 (105 residues), 103.6 bits, see alignment E=2.9e-33 PF00639: Rotamase" amino acids 186 to 277 (92 residues), 66.7 bits, see alignment E=9.1e-22 amino acids 295 to 385 (91 residues), 91.4 bits, see alignment E=1.8e-29

Best Hits

Swiss-Prot: 93% identical to SURA_PSEF5: Chaperone SurA (surA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 98% identity to pba:PSEBR_a5136)

MetaCyc: 42% identical to chaperone SurA (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>PFR28_04062 Chaperone SurA (Pseudomonas sp. RS175)
MNVKTKLSDCLRPLMLGALFLGTAANAAVQSIDKVVAIVDNDVVMQSQLDQRVHEVQQTI
AKRGGGLPPPGVLDQQVLERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNNMTIDQ
FRAALARDGLSYEDARDQIRREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKMQLSEE
LHLANILIPTPESANSEAIQSAYRQAMDVYQQLKQGADFGQMAVARSGSENALEGGDMGW
RKAAQLPPPFDRELSAMAVGDITQPARTPGGFIILKLLEKRGGGTQVRDEVHVRHILIKP
SEIRSEAETQRLAEKLYDRIEAGEDFAELAKSFSEDPGSALNGGDLNWVDPNALVPEFRQ
VMAETPQGQLSKPFKSPYGWHVLEVLGRRATDSTTQAREQQAMTVLRNRKYDEELQTWLR
QIRDEAYVEIKLPGADQAAQ