Protein Info for PFR28_04051 in Pseudomonas sp. RS175

Annotation: Inner membrane ABC transporter permease protein YdcV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 258 (173 residues), 63.3 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 98% identity to pba:PSEBR_a5125)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>PFR28_04051 Inner membrane ABC transporter permease protein YdcV (Pseudomonas sp. RS175)
MLSPYMSPVERVWFYCLRTLCGLILLFLILPVLVIVPLSFNSGSFLVYPLQGFSLQWYHD
FFASAEWMRALKNSIIVAPAATLLAMVFGTLAAIGLTRGDFPGKSLVMALVISPMVVPVV
IIGVASYLFFAPLGMGNSFFSLIVVHAVLGVPFVIITVSATLQGFNHNLVRAAASLGASP
LTAFRRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQATLPRQMFSGIRENLSPT
IAAAATLLIAFSVILLLTLEWLRGRGEKLRTTQV