Protein Info for PFR28_04037 in Pseudomonas sp. RS175

Annotation: putative oxidoreductase EphD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00106: adh_short" amino acids 4 to 194 (191 residues), 150.6 bits, see alignment E=7.7e-48 PF01370: Epimerase" amino acids 5 to 125 (121 residues), 22.5 bits, see alignment E=1.4e-08 PF08659: KR" amino acids 6 to 165 (160 residues), 41.4 bits, see alignment E=3.1e-14 PF13561: adh_short_C2" amino acids 9 to 203 (195 residues), 99.9 bits, see alignment E=3.5e-32

Best Hits

Swiss-Prot: 33% identical to YOXD_BACSU: Uncharacterized oxidoreductase YoxD (yoxD) from Bacillus subtilis (strain 168)

KEGG orthology group: K07124, (no description) (inferred from 95% identity to pba:PSEBR_a5111)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>PFR28_04037 putative oxidoreductase EphD (Pseudomonas sp. RS175)
MTRYALITGASSGIGLAMAEALARRGRNLILVARQRDRLESIAIELTQRFGVEVLFRACD
LGEPLRLSGFLLELEEGERQIDLLVNCAGIGTCGPFLGQDWMTEQDLIEVNILALTRLCH
AVGNSMALHGGGQILNVASIAAFQPGPWMSTYYASKAYVLHFSEALRVELKKCAIKVSVL
CPGPTRTDFFARAQLDERKLIDSQLLMSPEEVALYTVRALDKNRAIIIPGRRNRWLARLP
RLGPRWLVRTLAGMINKAYCPR