Protein Info for PFR28_04023 in Pseudomonas sp. RS175

Annotation: Bifunctional ligase/repressor BirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08279: HTH_11
  • amino acids 2 to 54 (53 residues), 42 bits, 1.1e-14
• TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase
  • amino acids 77 to 312 (236 residues), 204.6 bits, E=8.3e-65
• PF03099: BPL_LplA_LipB
  • amino acids 81 to 205 (125 residues), 80.2 bits, E=2.1e-26

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 83% identity to pba:PSEBR_a5102)

Predicted SEED Role

"Biotin operon repressor / Biotin-protein ligase (EC 6.3.4.15)" in subsystem Biotin biosynthesis (EC 6.3.4.15)

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (5/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (5/18 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Protein Sequence (318 amino acids)

>PFR28_04023 Bifunctional ligase/repressor BirA (Pseudomonas sp. RS175)
MLTLLELLKDGRFHSGQALGAALGISRSAVWKQLQHLEAELGLSIHKVRGRGYQLAKPLQ
LLNAAEIGAQESCDWPVHIFDSIDSTNAEALRSIERGMHAPFLILAERQTAGRGRRGRKW
VSPFADNLYYSLVLRIDGGMRQVEGLSLAVGLAVLRALRDMGVLEAGLKWPNDLLVGDKK
IAGILLELVGDPADVCHVVLGVGINVNMQSADEVDQQWTSMSLETGRNFNRNELVARLGG
SLRQYLSLHQASGFSALQAEWERYHLWQGRSVSLVAGANRIDGVVLGVDRQGALRLKVDG
VERIFSGGELSLRLRDDS