Protein Info for PFR28_03957 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 291 to 315 (25 residues), see Phobius details amino acids 335 to 365 (31 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details PF12704: MacB_PCD" amino acids 19 to 208 (190 residues), 54.1 bits, see alignment E=2.7e-18 PF02687: FtsX" amino acids 294 to 412 (119 residues), 70.6 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 96% identity to pba:PSEBR_a5048)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>PFR28_03957 hypothetical protein (Pseudomonas sp. RS175)
MYLFRLAMASLANRRFTAFLTAFAIALSVCLLLAVERVRTEARASFASTISGTDLIVGAR
SGSVNLLLYSVFRIGNATNNIRWDSFEHFASNPKVKWAIPMSLGDSHRGYRVMGTTEAYF
EHYRYGRQQHLALADGRAFATDPFEVVLGAEVAEALHYKLGDKLVLAHGVATVSLVKHDD
KPFTVVGILKRTGTPVDRTLHISLGGMEAIHIDWKNGVPAQGNGRISADQARNMDLTPQA
ITAFMLGLNNKISTFALQREVNEFRGEPLLAILPGVALQELWSLMGTAEKALFVISLFVV
LTGLIGMLTAILTSLNERRREMAILRSVGARPWHIASLLVLEAFALALAGVAAGLVLLYV
GIAAAQGYVQSTYGLYLPLAWPSEYEWTLMAGILVAALLMGTVPAWRAYRQSLADGLSIR
L