Protein Info for PFR28_03921 in Pseudomonas sp. RS175

Annotation: Inner membrane protein YnbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 177 to 193 (17 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 28 to 183 (156 residues), 26.1 bits, see alignment E=5e-10

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 92% identity to pba:PSEBR_a5007)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>PFR28_03921 Inner membrane protein YnbA (Pseudomonas sp. RS175)
MPSIYQLKPAFQNLLRPMVQRLYDKGVTANQVTVLAGAVSVLVGAIVAGFAQHPWVFVLV
PAWMFLRMALNAVDGMLAREFGQQSHLGAYLNELCDIIADAALILPFALIPDASLLLVLS
VTLLALFSEYAGVLGPMVGASRRYDGPMGKSDRAFVLGVLATGIALGWLGAPWVDGVMAV
VAALLVYTLVNRVRHGLDQVKENAPSA