Protein Info for PFR28_03889 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF00583: Acetyltransf_1" amino acids 28 to 136 (109 residues), 50.9 bits, see alignment E=2.7e-17 PF13673: Acetyltransf_10" amino acids 40 to 141 (102 residues), 34.8 bits, see alignment E=2.2e-12 PF13508: Acetyltransf_7" amino acids 57 to 138 (82 residues), 41.7 bits, see alignment E=1.8e-14

Best Hits

Swiss-Prot: 39% identical to YHFO_BACSU: Uncharacterized N-acetyltransferase YhfO (yhfO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a4986)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>PFR28_03889 hypothetical protein (Pseudomonas sp. RS175)
MRIIQATLEHLDLLTPLFVKYREFYGSLPYPDSSRAFLEKRLRRKESVIYLALPDDDDNK
LLGFCQLYPSFSSLSLKRVWILNDIYVAEDARRQLVADHLIRTAKKMAKETNAVRMRVST
SSNNEAAQKTYESIGFKEDTEFKNYVLPISEGI