Protein Info for PFR28_03876 in Pseudomonas sp. RS175

Annotation: Inner membrane protein YohK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details PF04172: LrgB" amino acids 23 to 235 (213 residues), 247.9 bits, see alignment E=3.7e-78

Best Hits

Swiss-Prot: 42% identical to YOHK_SHIFL: Inner membrane protein YohK (yohK) from Shigella flexneri

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a4972)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>PFR28_03876 Inner membrane protein YohK (Pseudomonas sp. RS175)
MMLDWQGAWTSVIHHPLFGIGITLGAYQLVLAAFEKTRWIFLQPVLMSMLVLIGVLVGCG
ISYAEYRKSTEILSILLGPATVALAVPLYLNLRRIRQLFWPIFTTLVIGGVFATGSAVLL
GWALGAEHMILMTMAPKSVTSPIAMLVAEQIGGVAAMAAVFVLITGVLGAILGPGILDRL
GVRSPEARGMALGLTAHAVGTSVALQESEESGAFAALAMSLMGVATAVLLPLVVSMTV