Protein Info for PFR28_03844 in Pseudomonas sp. RS175

Annotation: Thiamine-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 6 to 197 (192 residues), 201.4 bits, E=4.5e-64
• PF02581: TMP-TENI
  • amino acids 6 to 184 (179 residues), 203.2 bits, E=1.1e-64

Best Hits

Swiss-Prot: 89% identical to THIE_PSEPF: Thiamine-phosphate synthase (thiE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 95% identity to pba:PSEBR_a4940)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (208 amino acids)

>PFR28_03844 Thiamine-phosphate synthase (Pseudomonas sp. RS175)
MKLRGLYAITDSQLLAGKFLAYVEAALEGGVTLLQYRDKSSDEARRLREAEALRNLCERY
KTQLIINDDAELAARLGVGVHLGQTDGPLAPVRALLGRKAIIGSTCHSSLELAEQAASEG
ASYVAFGRFFNSNTKPGAPSANLELLEQARVKLHIPVCAIGGITLDNAAPLVAHGVDLLA
VVHGLFGADSTAEVTRRARAFNSLLHIN