Protein Info for PFR28_03831 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details PF06790: UPF0259" amino acids 63 to 212 (150 residues), 31.7 bits, see alignment E=7.2e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a4927)

Predicted SEED Role

"FIG00958173: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>PFR28_03831 hypothetical protein (Pseudomonas sp. RS175)
MNPLDVLRDSLYFFKRHLGRIAGLCLPLVILEAVLQQGVDSAVGPDGFPGYSLIVGLLVY
PLYTAALILFLDARSRGESPRARDLLAAALTLWPRFAVLTALNTLLILLGISLYLLPGLW
LMVTLAFSEYLLVLRGLAPLAAMKQSLRMSRGRFWRILLCILGVMGPLWLLKGASVSVYP
PPQTPWVTLLIDSVHSFLQLFTSVVLFRMFMLIEEKTDNS