Protein Info for PFR28_03798 in Pseudomonas sp. RS175

Annotation: Ribosomal RNA large subunit methyltransferase G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 201 to 371 (171 residues), 174.4 bits, E=5e-55
• PF06325: PrmA
  • amino acids 231 to 306 (76 residues), 37.3 bits, E=6.6e-13
• PF13847: Methyltransf_31
  • amino acids 233 to 312 (80 residues), 40.8 bits, E=5.9e-14
• PF13649: Methyltransf_25
  • amino acids 235 to 335 (101 residues), 31.1 bits, E=9.5e-11
• PF08242: Methyltransf_12
  • amino acids 237 to 335 (99 residues), 32.1 bits, E=4.8e-11

Best Hits

Swiss-Prot: 90% identical to RLMG_PSEPF: Ribosomal RNA large subunit methyltransferase G (rlmG) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 92% identity to pba:PSEBR_a4894)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Protein Sequence (374 amino acids)

>PFR28_03798 Ribosomal RNA large subunit methyltransferase G (Pseudomonas sp. RS175)
MPLLDSPFAQLDLIRQPEQQNEPLQAFDAADEYLLAHLAEQQPATSTRVLVLNDGFGALA
ASLAGKVNVISSSDSFLALQALEKNLVRNGRAFDAVPTLPASEPLVGPFDRVLIKVPKTL
ALLEEQLIRLQGQLAPGAQVIAAAMVKHLPRAAGDLLERYIGPVQASLAVKKARLLIATP
ADRAPAVSPYPTRYLLEEPKIELLNHANVFCREGLDIGTRAFLPHLPKNLGAAQVADLGC
GNGVLAIASALQNPQAHYTLVDESYMAVQSAAENWRAALGEREMTVRAGDGLAGQAAQSL
DVVLCNPPFHQQQVVGDFLAWRMFQQAREALVVGGALYIVGNRHLGYHSKLARLFRGVEQ
VAATPKFVILKARK