Protein Info for PFR28_03696 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01066: CDP-OH_P_transf
  • amino acids 42 to 206 (165 residues), 71.9 bits, E=4.1e-24
• TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase
  • amino acids 48 to 224 (177 residues), 118 bits, E=2e-38

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 99% identity to pba:PSEBR_a4791)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.8

Use Curated BLAST to search for 2.7.8.8

Protein Sequence (281 amino acids)

>PFR28_03696 hypothetical protein (Pseudomonas sp. RS175)
MSERPDEPNQAPDAESMLPIDEHVEEGHDAEGRKVRHRGIYLLPNLFTTANLFAGFYSII
SSMSAQAALSAGDAAGASRYFAFAAIAIFVAMVLDGLDGRVARMTNTQSAFGAEYDSLSD
MVAFGVAPALLAFGWALGDMGKVGWMVAFIYVAGAALRLARFNTQVGKADKRYFIGLASP
AAAGVVAGVVWAFSDYGIQGSKMSFLVALLVAAAGMLMVSNIKYNSFKELDLKGRVPFVA
ILAVVLVFAVVFSDPPRILLLVFLAYAASGPAQYLLRLRRG