Protein Info for PFR28_03657 in Pseudomonas sp. RS175

Annotation: Beta-barrel assembly-enhancing protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF13432: TPR_16" amino acids 204 to 254 (51 residues), 20.6 bits, see alignment 4.4e-07 amino acids 244 to 287 (44 residues), 17 bits, see alignment 5.6e-06 amino acids 284 to 327 (44 residues), 18.2 bits, see alignment 2.3e-06 amino acids 480 to 540 (61 residues), 30 bits, see alignment E=5e-10 PF14559: TPR_19" amino acids 215 to 273 (59 residues), 39.4 bits, see alignment 5e-13 amino acids 454 to 510 (57 residues), 34.8 bits, see alignment 1.4e-11 amino acids 487 to 540 (54 residues), 25.9 bits, see alignment 8.2e-09 PF07719: TPR_2" amino acids 474 to 505 (32 residues), 23.9 bits, see alignment (E = 2.5e-08) PF13374: TPR_10" amino acids 476 to 502 (27 residues), 20.9 bits, see alignment (E = 2.2e-07) PF13181: TPR_8" amino acids 478 to 505 (28 residues), 13.2 bits, see alignment (E = 6.8e-05) PF07721: TPR_4" amino acids 478 to 498 (21 residues), 13.6 bits, see alignment (E = 7.1e-05) amino acids 508 to 529 (22 residues), 10.6 bits, see alignment (E = 0.00068) PF13174: TPR_6" amino acids 479 to 505 (27 residues), 16.1 bits, see alignment (E = 1.2e-05)

Best Hits

Swiss-Prot: 70% identical to Y4667_PSEAE: TPR repeat-containing protein PA4667 (PA4667) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a4760)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (555 amino acids)

>PFR28_03657 Beta-barrel assembly-enhancing protease (Pseudomonas sp. RS175)
MDPVSTDGTPPVEDSTQAPEKPKVYGSFSEETIFSLLSAELAGQRNRFDIALDNYVTQAI
NTQDPGISERAFRIAEYLGADQAALDTAMIWAKNAPDDLEAQRAAAVQLARAGRYDDSML
YMEKVLLGKGDTHFDFLALSAADTDQETRSGLMKSFDRLLQRHPNNGQLIFGKALLLQQD
GDSQGALTLLEDNPPEAGEVAPILLRARLLQGLNRGDEALPLLEKSIRKYPDDKRLRLTY
ARMLVENNRMDDAKVEFSSLVQQYPEDDELRYSLALVCLEAKAWEEAKGYLEDLIARESH
VDSAHLNLGRIAEERNDPETALIEYAQVGPGNDYLPAQLRQADILMSNGKTAEAQSRLSV
QRDAQPDYGIQLYLIEAETLSANNQGDKAWNVLQQALKQYPDDLNLLYTRAMQAEKRNDL
AQMEKDLRLIIQRDPDNAMALNALGYTLSDRTTRYDEAKVLIEKAHQINPEDPAVLDSLG
WVNYRLGNLDEAERLLRQALERFPDQEVAAHLGEVLWANGKQREARQVWSKFLKEQPDSP
ILRGTIKRLTGSETL