Protein Info for PFR28_03653 in Pseudomonas sp. RS175

Annotation: Molybdopterin-synthase adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details PF00899: ThiF" amino acids 13 to 248 (236 residues), 227.3 bits, see alignment E=1.3e-71

Best Hits

Swiss-Prot: 55% identical to MOEB_ECOLI: Molybdopterin-synthase adenylyltransferase (moeB) from Escherichia coli (strain K12)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 93% identity to pba:PSEBR_a4756)

MetaCyc: 55% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>PFR28_03653 Molybdopterin-synthase adenylyltransferase (Pseudomonas sp. RS175)
MHAVLSDQELLRYSRQILLQHVDIDGQVRLKQSRALIVGLGGLGAPVALYLAAAGVGELH
LADFDTVDLTNLQRQIIHDTDSVGLGKVDSAMRRLTAINPEVRLVPHNTAMDEDSLAAVV
ATVDVVLDCSDNFSTREAVNAACVRAGKPLVSGAAIRLEGQLSVFDPRRPESPCYHCLYG
HGSEAELTCSEAGVVGPLVGLVGSLQALEALKLLVGFGEPLVGRLLLIDALGSRFRELRV
KRDPGCSVCGSQHA