Protein Info for PFR28_03580 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF02743: dCache_1" amino acids 50 to 281 (232 residues), 56 bits, see alignment E=4.2e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 331 to 496 (166 residues), 172.7 bits, see alignment E=2.7e-55 PF00990: GGDEF" amino acids 335 to 493 (159 residues), 165.4 bits, see alignment E=9.3e-53

Best Hits

KEGG orthology group: None (inferred from 87% identity to pba:PSEBR_a4614)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>PFR28_03580 hypothetical protein (Pseudomonas sp. RS175)
MSASSATPGTTQPSKPSERALVLASSLVVIAILSIVTFLLIREHASAQQAATRAATNIVQ
LIDADVLRNVELYDLSLQGLIATAKRDDLKEVSPTVRHLALFDRATAAPYKGDILLLDKH
GDVIADSASIEPRKGNYADREYFQSHRQNPDLGMMISRPFRSRSAAHDWRISFSYRINDE
RGEFIGVAEAAMRLNYFSQLFKSLNIGHGGTVNLVSRDGFLLAQEPPLAEDMIGKDFSNR
PNFMRILREGDGSFTSVSSVDQTQRLYTFSQVGNLPLIVVVALSSQEVFASWQRTALLVS
GATGALCIGLLWLTWLLRRELRRRHSAERELAQQASTDALTGLANRRTLDETLQQEWLRA
QRSGQPLSVLMIDADHFKAFNDRHGHQGGDEALQALAQLIGEHVRRPADLAARYGGEEFS
VVLPETTTAGAFAMAQHIREAVEQQPPRILGDGPMTVSIGIATWAQGPYGELEELLFAAD
KALYQAKASGRNRVVCAM