Protein Info for PFR28_03551 in Pseudomonas sp. RS175

Annotation: Cyclic pyranopterin monophosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 2 to 149 (148 residues), 221.3 bits, E=2.3e-70
• PF01967: MoaC
  • amino acids 13 to 147 (135 residues), 192 bits, E=2.2e-61

Best Hits

Swiss-Prot: 88% identical to MOAC_PSEU2: Cyclic pyranopterin monophosphate synthase (moaC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 96% identity to pba:PSEBR_a4586)

MetaCyc: 67% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Protein Sequence (157 amino acids)

>PFR28_03551 Cyclic pyranopterin monophosphate synthase (Pseudomonas sp. RS175)
MLTHLDSLGRANMVDVTDKAVTFREATAEAFVRMLPDTLQMIVSGGHPKGDVFAVARIAA
IQAAKKTSDLIPLCHPLMLTSVKVELSAEGQERVRIVARCKLSGQTGVEMEALTAASVAA
LTIYDMCKAVDRGMTIEGVRVLEKLGGKSGHFQADAP