Protein Info for PFR28_03536 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF01541: GIY-YIG" amino acids 22 to 92 (71 residues), 52.5 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 52% identical to Y3539_VIBCH: UPF0213 protein VC_A0739 (VC_A0739) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07461, putative endonuclease (inferred from 84% identity to pba:PSEBR_a4568)

Predicted SEED Role

"FIG00955494: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>PFR28_03536 hypothetical protein (Pseudomonas sp. RS175)
MTNANLSADPPVHAASEPPKPWFVYLVRAANGSLYCGISDDPVRRFAKHQSGKGARFFLS
SPAVALVYTEACRDKGEALRQERLIKKLRKSAKECLVASAARSHQPD