Protein Info for PFR28_03515 in Pseudomonas sp. RS175

Annotation: Putative PTS system glucosamine-specific EIICBA component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details TIGR01998: PTS system, N-acetylglucosamine-specific IIBC component" amino acids 9 to 457 (449 residues), 571.2 bits, see alignment E=1.7e-175 PF02378: PTS_EIIC" amino acids 14 to 303 (290 residues), 244.4 bits, see alignment E=1.7e-76 TIGR00826: PTS system, glucose-like IIB component" amino acids 360 to 445 (86 residues), 52.7 bits, see alignment E=4.2e-18 PF00367: PTS_EIIB" amino acids 389 to 419 (31 residues), 37.8 bits, see alignment (E = 1e-13)

Best Hits

KEGG orthology group: K02803, PTS system, N-acetylglucosamine-specific IIB component [EC: 2.7.1.69] K02804, PTS system, N-acetylglucosamine-specific IIC component (inferred from 88% identity to pba:PSEBR_a4546)

Predicted SEED Role

"PTS system, N-acetylglucosamine-specific IIA component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylglucosamine-specific IIC component (EC 2.7.1.69)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>PFR28_03515 Putative PTS system glucosamine-specific EIICBA component (Pseudomonas sp. RS175)
MYQHFIEGLQRLGRALMLPIAILPIAGLLLRLGDTDLLNIAIIHDAGQAIFANLPMIFAI
GIAVGFARDNNGTAGLAGAIGYLVMIATLKVLDASINMGMLAGIISGLLAGALYNRFKDI
KLPEYLAFFGGRRFVPIVTGFSAVGLGVVFGLIWPPIQAGINGFGALLMESGSFGAFVFG
VFNRLLIVTGLHHILNNMAWFIFGSFTDPQTGAVVTGDLTRYFAGDPNGGQFMTGMFPVM
LFGLPAACLAMYRNALPQRRKVMGGILLSMALTSFLTGVTEPVEFAFMFLAPLLFLLHAL
LTGLSMAITDWLNIRLGFTFSGGFIDMVLGWGKSSNGWLVVPVGLVYAVIYYTVFDFCIR
RFDLKTPGREDVPAMDKPVVAQHQRAGAYIQALGGADNLITVGACTTRLRLDMVDRNKAC
DAQLKALGAMAVVRPGNGGSLQVVVGPMADSIADEIRLALPASDRHASTGAATANETAAT
PVVPAAEARQWMDALGGEGNVLQLDCVAMSRLRVRLADGRQLSESQLRTLGCQGVSALEG
GVWHLLLGERAPTLWQALEAMVLSRQADVKA