Protein Info for PFR28_03512 in Pseudomonas sp. RS175

Annotation: N-acetylgalactosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01979: Amidohydro_1
  • amino acids 41 to 349 (309 residues), 57.3 bits, E=8.2e-20
• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 41 to 360 (320 residues), 243.4 bits, E=1.8e-76

Best Hits

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 95% identity to pba:PSEBR_a4543)

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• peptidoglycan recycling I (11/14 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• N-acetylglucosamine degradation II (2/3 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (2/4 steps found)
• N-acetyl-D-galactosamine degradation (2/5 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (2/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Protein Sequence (368 amino acids)

>PFR28_03512 N-acetylgalactosamine-6-phosphate deacetylase (Pseudomonas sp. RS175)
MSEDNILTPDGWVRGRLLHEHGKVVSIEGQPCDPASNDLPYLLPGFIDLHVHGGGGKDIM
QGASAFETIARTHVRFGTTALLATTMTAPSEEIASVLQALGEFCEQRPSSSARVLGVHLE
GPYINPGKLGAQPNFAHTALLAEVERYLALAPIRVITIAPEIAGHDALIRALSARGVRMQ
IGHTLGSYEEGVAALAAGATSFTHLYNAMSPLHHREPGIVGAALAHARYAELIPDLLHVH
PGAMRVALRSIPCLYCVTDSTAAAGMPDGEYRLGSHTVTKCLGGVRLADGTLAGSTLTMD
QALRNLVKIGLPLAEASQRLSQFPADYLGLPERGRLQPGAWADCVRLDRYLTLTDVTVEG
EAIDFKNA