Protein Info for PFR28_03503 in Pseudomonas sp. RS175

Annotation: Quinoprotein glucose dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 804 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 66 to 82 (17 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details TIGR03074: membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family" amino acids 16 to 803 (788 residues), 1175.5 bits, see alignment E=0 PF13360: PQQ_2" amino acids 221 to 411 (191 residues), 29.8 bits, see alignment E=7e-11 amino acids 310 to 528 (219 residues), 21.1 bits, see alignment E=3.4e-08 amino acids 684 to 771 (88 residues), 23.1 bits, see alignment E=7.9e-09 PF01011: PQQ" amino acids 309 to 340 (32 residues), 22.9 bits, see alignment (E = 7.9e-09) amino acids 463 to 488 (26 residues), 20.6 bits, see alignment (E = 4.3e-08) amino acids 678 to 711 (34 residues), 27.7 bits, see alignment (E = 2.5e-10) amino acids 736 to 768 (33 residues), 22.1 bits, see alignment (E = 1.5e-08)

Best Hits

KEGG orthology group: K00117, quinoprotein glucose dehydrogenase [EC: 1.1.5.2] (inferred from 97% identity to pba:PSEBR_a4532)

Predicted SEED Role

"Glucose dehydrogenase, PQQ-dependent (EC 1.1.5.2)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway or Respiratory dehydrogenases 1 (EC 1.1.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (804 amino acids)

>PFR28_03503 Quinoprotein glucose dehydrogenase (Pseudomonas sp. RS175)
MSTEGALSRSRLLPSLLGILLLLMGLALLAGGVKLSMLGGSLYYLLAGIGLALTGVLLIM
ARRAALGLYALVLFASTVWALWEVGLDWWQLVPRLAMLFALGIVLLLPWFRRPLLSAEAS
NMGTRALGAAVVIAGVAALASQFTNPGEIKGQLDRDAVPGMTNTAPAMPDGDWNSYGRSA
HGDRYSPLAQITPQNVSKLVPAWTYRTGDLPGPNDPGETTAENTPLKANGMLYVCTPHSQ
VIALEPETGKEIWRFDPKLSTQKAENFKGWAHMTCRGVTYHDDAVYASAEQSPTGTASTT
PASTVCPRRIFLPTADTRLIALNADTGKMCEDFGDKGQVDLTANIGSFTAGGYYSTSPPA
VTQNLVVIGGHVTDNVSIDEPSGVIRAYDVHTGKLVWNWDSGKPDDTTPIAEGQVYTRNS
PNMWSMFSVDEKLGMLYLPMGNQTPDQFGGMRTPESEKYAAGLTALDIATGKVRWYFQFT
HHDLWDMDVGGQPTLMDLKTADGVKPAVLASTKQGSIYVLDRSNGQPIVPIKEIPVPQGA
VEGDYTSPTQPMSDLNFVPPVLKESDMWGVTPFDQMLCRIDFKSLRYEGMFTPPSLQGSI
VYPGNFGVFDWGGISVDPVRQIAFVNPSYMAFKSKLVPAAEVAGGPGRKSETEGVQPNKG
APYGVILEALLSPMGLPCQAPAWGYVAAVDLTNNKTLWKHKNGTVRDSSPVPIPLSMGVP
SLGGTFTTASGLAFLSGTLDQYLRAYDVKNGKQLWEGRLPAGAQTTPMTYTGKDGKQYVL
VVAGGHGSLGTKQGDYVIAYKLPD