Protein Info for PFR28_03483 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 801 PF08447: PAS_3" amino acids 248 to 333 (86 residues), 52.2 bits, see alignment E=1.5e-17 TIGR00229: PAS domain S-box protein" amino acids 256 to 346 (91 residues), 41.7 bits, see alignment E=1.2e-14 PF08448: PAS_4" amino acids 256 to 341 (86 residues), 32.7 bits, see alignment E=1.8e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 350 to 511 (162 residues), 138.2 bits, see alignment E=2.2e-44 PF00990: GGDEF" amino acids 352 to 508 (157 residues), 154.9 bits, see alignment E=4e-49 PF00563: EAL" amino acids 528 to 765 (238 residues), 195.7 bits, see alignment E=2.1e-61

Best Hits

KEGG orthology group: None (inferred from 92% identity to pba:PSEBR_a4512)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (801 amino acids)

>PFR28_03483 hypothetical protein (Pseudomonas sp. RS175)
MLYPMKGQVQARLLMPVKGISDVPTVQSSASPRCTAMSLPLDKANRRILIVDDTQTIHED
FRKILSPQEAPEDSLSSAEEALFGAPVAAASHSFILDSAFQGMEALNKVETALEQGQPYA
MAFIDMRMPPGWDGLETIERLWRVDPKLQVALCTAYSDYSWEDIADRLELGDRLLILKKP
FDAIEIRQMASTLTVKWQMTEDAALKMDMLEQAVQERTRELADANIIVQNSPTILYRLRG
EPPFPLMYISHNITKFGHVAAQLVNSPEWAQMLIHPDDQAKIDQAMVRVLDRDTTGASIE
FRMRTGDGSFRWVENRYIPVRNEQGLLLEVEGIILDITERKLAEEKIALLARTDSLTGLA
NRATVIERLHQAFAAARRGAAPFAMFYLDLDHFKRINDTLGHPIGDLLLQEVAKRLKDCT
RENDVVARLGGDEFAILQLDVHEPTHCAALAAKIRDTLVAPYSLDGNDVRISVSIGIALY
TPQSPSADSLMAQSDMALYRSKEKGRNQYHFHNEEINQEVTDRVTLTNELRQAIENNELQ
LHYLPEVDLGTGKILGMGVQVRWKHPERGWLEPSAFMPAAEKSGIIVALGHWVLDQACQQ
MRQWRDQGMAPPVIAIDLSLTQLKTGPELIYDVLRTTARWELAPWDLRFDVTEATLAQTK
WTHNDVLPRLCELGVQIAIDDFGTEYSSFDYLKTYRVNHLKLAQRFLDSANADPENATTL
RAIINFARDVGIGIIAEGVETQEQRTTLMSSGSGGPILAQGHYFSTVVDSGQAGELLKAG
TIVPVTDHWTRPASQLSESNP