Protein Info for PFR28_03462 in Pseudomonas sp. RS175

Annotation: C4-dicarboxylate transport transcriptional regulatory protein DctD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF00072: Response_reg" amino acids 10 to 118 (109 residues), 103.5 bits, see alignment E=2.2e-33 PF00158: Sigma54_activat" amino acids 150 to 315 (166 residues), 221.7 bits, see alignment E=1.5e-69 PF14532: Sigma54_activ_2" amino acids 150 to 320 (171 residues), 78 bits, see alignment E=2.6e-25 PF02954: HTH_8" amino acids 399 to 437 (39 residues), 28.2 bits, see alignment 4e-10

Best Hits

Swiss-Prot: 52% identical to DCTD_RHILE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium leguminosarum

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 95% identity to pba:PSEBR_a4490)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>PFR28_03462 C4-dicarboxylate transport transcriptional regulatory protein DctD (Pseudomonas sp. RS175)
MPSESLLQNVMVVDDEASIRSAVEQWLSLSGFQVQLFGRAEECLASLPEHFAGVILSDVR
MPGLSGLELLAEVRRRDPDLPVILLTGHGDVPMAVEAMRDGAYDFLEKPFSPEALLGSLR
RALDKRALVLENRRLHEQADARARLDGTLLGVSRALQNLRRQVLDLATLPVNVLIRGETG
SGKELVARCLHDFGPRASKPFVALNCAAIPEPLFEAELFGHESGAFTGAQGKRIGKLEYA
DGGTLFLDEIESMPLAQQVKLLRVLQEQKLERLGSNQSIAVDLRIVAATKPDLLEEARAG
RFREDLAYRLNIAELRLPPLRERREDIPLLFEHFTHSAAERLGRRAAPLSGPQLSHLLSH
DWPGNVRELANVAERQLLGLDQPHLLESEPGQSLAARQEAFEAQCLRAALARHKGDVKAV
LEELQLPRRTFNEKMQRHGLSREMFLQDS