Protein Info for PFR28_03435 in Pseudomonas sp. RS175

Annotation: GDP-mannose-dependent alpha-mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13579: Glyco_trans_4_4
  • amino acids 8 to 159 (152 residues), 57.2 bits, E=6.4e-19
• PF13439: Glyco_transf_4
  • amino acids 8 to 169 (162 residues), 79.2 bits, E=9.5e-26
• PF00534: Glycos_transf_1
  • amino acids 178 to 320 (143 residues), 87.4 bits, E=2.1e-28
• PF13692: Glyco_trans_1_4
  • amino acids 191 to 318 (128 residues), 81.5 bits, E=1.9e-26
• PF13524: Glyco_trans_1_2
  • amino acids 263 to 346 (84 residues), 27.3 bits, E=8.9e-10

Best Hits

KEGG orthology group: K14335, alpha-1,6-mannosyltransferase [EC: 2.4.1.-] (inferred from 96% identity to pba:PSEBR_a4462)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (363 amino acids)

>PFR28_03435 GDP-mannose-dependent alpha-mannosyltransferase (Pseudomonas sp. RS175)
MFYAPASGGVRTYLDAKHRRLANRPGIRHSLLIPGAHLSEQDGIYKVPAPPLPFGKGYRF
PLRLAPWRNALRDLQPDLIEVGDPYLTAWAALDARRQLDVPVIGFYHSDLPLLVSNRMGN
WFTPNIEAYVSKLYGNFDRVLAPSQVMADKLTGLGVRNVFVQPLGVDLQTFNPAARDPEL
RAELGIAEDARLLIFAGRGSKEKNLPVLLKCMKRLGERYHLLLVGSSMPAAVPENVTVID
EFCPAPQVARLMASADALLHAGDQETFGLVILEAMASGIPVVAVAAGAFTEIVHEDCGLL
CMPNNPQAMANAVRQLFSEGCQRRGALARRHVERHYAWDCVVDSLLGHYYAVLGEQMPLL
ANG